Skip to content

Folders and files

NameName
Last commit message
Last commit date

Latest commit

 

History

1 Commit
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 

Repository files navigation

Energy-Efficient Codon Optimization on Thermodynamic Hardware

This repository is the companion code for the paper "Energy-Efficient Codon Optimization on Thermodynamic Hardware" (A. Jelinčič and R. C. Walker, Extropic). The manuscript is included in paper/ (paper/main.pdf and paper/supplement.pdf); it is being released on arXiv and has been submitted to a journal.

The paper formulates mRNA codon optimization as sampling from a probabilistic graphical model and maps it onto a Thermodynamic Sampling Unit (TSU) — a sub-threshold analog CMOS Ising machine that performs single-site Gibbs sampling at extremely high speed and low energy. It benchmarks three approaches on the SARS-CoV-2 spike protein and finds they reach comparable solution quality, while energy estimates grounded in prototype hardware measurements indicate a TSU could solve the problem using ~5–9 orders of magnitude less energy than a GPU.

This code provides those three approaches so that readers can reproduce, inspect, and experiment with them:

  1. Potts model sampler — direct categorical formulation (potts/).
  2. Ising model sampler — Potts compiled to binary spins via domain-wall encoding for binary (p-bit) hardware (ising/).
  3. Genetic algorithm baseline — the reference implementation from Fox et al. plus a tuned JAX reimplementation (qodon/).

The Potts and Ising samplers are built on the open-source THRML library, which provides the block-Gibbs sampling primitives. The current JAX implementation simulates what a TSU would do, validating the algorithmic approach before hardware deployment.


Installation

The code is a flat-layout research repo: there is no installable package, and the scripts are run as modules from the repository root (the directory containing this README). The one non-PyPI dependency is THRML, which is installed directly from GitHub.

Option A — uv (recommended)

uv reads pyproject.toml, creates a local .venv, and installs everything (including THRML from GitHub):

# Install uv if you don't have it: https://docs.astral.sh/uv/getting-started/installation/
uv sync                 # runtime dependencies
uv sync --extra dev     # also install pytest (for the test suite)

# Run anything with `uv run` (no manual venv activation needed):
uv run python -m potts.main --help

Option B — pip

python -m venv .venv
source .venv/bin/activate
pip install -r requirements.txt
pip install pytest        # only needed to run the tests

Notes

  • JAX backend. The dependencies install the CPU build of JAX, which is sufficient to run everything here. For GPU acceleration, follow the JAX install guide to replace jax/jaxlib with the CUDA wheel matching your system.
  • Headless plotting. The scripts save PNG figures and also call plt.show(). On a machine without a display, set MPLBACKEND=Agg (or pass --no_plot) to avoid blocking, e.g. MPLBACKEND=Agg uv run python -m potts.main ....

Quickstart

Run from the repository root. (Drop the uv run prefix if you activated a venv via pip.)

# Potts model: simulated annealing with adaptive GC (recommended approach)
MPLBACKEND=Agg uv run python -m potts.main \
  --seq "MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNI" \
  --anneal --beta_min 0.3 --beta_max 100 \
  --n_chains 256 --n_samples 100 --steps_per_sample 2 \
  --use_adaptive_gc_coeff --gc_coeff_adapt_mult 0.1 \
  --target_gc 0.5 --weight_usage 0.1 --weight_gc 2e4 --weight_repeat 0.2 \
  --codon_freqs ecoli --seed 42

# Full spike protein (1273 AA) — the paper's benchmark sequence
MPLBACKEND=Agg uv run python -m potts.main --seq spike_protein --anneal --use_adaptive_gc_coeff

See Usage below for the Ising entry point and the full argument list, and the qodon section for the GA baseline.


Motivation

The long-term target is deployment on a Thermodynamic Sampling Unit (TSU): a sub-threshold analog CMOS-based Ising machine that performs single-site Gibbs sampling at extremely high speed and low energy. The goal is an early demonstration of how thermodynamic computers can be useful for pharmaceutical applications.

The TSU's operational model has three phases: (1) flash weights from host to chip, (2) Gibbs sampling on the chip with fixed weights, and (3) read state back to host. The algorithm is designed around this: an outer loop on the host (compute weights, flash, read back, adapt parameters) wrapping an inner loop on the TSU (many Gibbs steps with fixed weights). The current JAX implementation simulates what the TSU would do, validating that the algorithmic approach works before hardware deployment.


Problem Specification

Goal

Given a protein sequence of length L, choose a synonymous codon at each amino-acid position to produce an mRNA sequence that is predicted to express well in a chosen host organism. This is a discrete combinatorial optimization problem: each position p has a small categorical choice set (the synonymous codons for that amino acid, at most 6), and the objective is a weighted sum of sequence-level and local penalties.

Inputs

  1. Protein sequence: amino acids a_1, ..., a_L.
  2. Synonymous codon sets: for each position p, a set S_p of codons encoding amino acid a_p. Each codon is a length-3 string over {A,C,G,T}.
  3. Host codon-usage frequencies: for each codon c, a frequency f_host(c) describing how common that codon is in the host (e.g. E. coli K-12).
  4. Target GC fraction: rho_T in [0,1], desired fraction of nucleotides that are G or C.
  5. Weights: c_f >= 0 (codon usage), c_GC >= 0 (GC content), c_R >= 0 (repeat penalty).

Energy Function

The optimization target is:

E(c_1,...,c_L) = c_f * sum_p u(c_p)
              + c_GC * ( (1/3L) * sum_p g(c_p) - rho_T )^2
              + c_R * sum_{p=1}^{L-1} r(c_p, c_{p+1})

where:

  • Codon usage cost (unary): u(c) = |log(f_host(c) / f_max_aa)|, which is 0 for the most common codon of each amino acid and positive for rarer codons.
  • GC count: g(c) = number of G or C nucleotides in codon c (0 to 3).
  • Repeat penalty (pairwise, adjacent positions only): r(c, c') = m(c||c')^2 - 1, where m is the length of the longest contiguous run of identical nucleotides in the 6-character concatenation. Zero when no nucleotide repeats across the boundary.

Structure of the terms:

  • The codon-usage term is unary: depends only on each codon independently.
  • The repeat-penalty term is local pairwise: depends on adjacent positions only.
  • The GC term is global: couples all positions through the squared deviation of the overall GC fraction from the target.

The output is the codon sequence minimizing E, and the resulting nucleotide string.

This formulation and its default weights follow Fox et al. (see the qodon section).


Solution Methods

We implement two sampling approaches. Both use simulated annealing with parallel Gibbs chains and an adaptive GC coefficient. (The genetic-algorithm baseline lives in qodon/.)

Approach 1: Direct Potts Model

The problem is naturally a Potts model (probabilistic graphical model with categorical variables). Each position p has a categorical variable X_p with |S_p| states (up to 6). All variables are padded to K_max=6 states, with invalid states receiving a very large negative bias (effectively -infinity).

The Potts energy decomposes into unary biases h_p(k) (codon usage + validity) and pairwise interactions J_p(k,k') (repeat penalty between adjacent positions). This gives a chain graph (each position interacts only with its neighbors), which is 2-colorable (even/odd positions).

Block Gibbs sampling. The 2-coloring enables parallel block updates: conditioned on odd positions, all even positions are conditionally independent and can be sampled simultaneously (via softmax + categorical sampling), and vice versa. One full Gibbs sweep = update even block, then odd block.

Simulated annealing. Starting from high temperature (low beta), we gradually increase beta on a log-spaced schedule. At each temperature step, we run several Gibbs sweeps, then update the temperature. Multiple chains run in parallel via jax.vmap.

Adaptive GC coefficient. The global GC term would require all-to-all pairwise interactions if expanded directly. Instead, we approximate it with an adaptive linear term: a per-chain coefficient lambda that adjusts the bias on each codon proportionally to its GC count. At each annealing step, lambda is updated based on the current GC fraction error (a Lagrangian-style update). The coefficient is clamped to never exceed the gradient of the true quadratic GC penalty, preventing the approximation from dominating other terms.

Approach 2: Ising Model via Domain Wall Encoding

For deployment on Ising hardware (spins in {-1,+1}), we compile the Potts model into an Ising model using domain wall encoding (DWC). A K-state Potts variable is represented by K-1 binary spins in a "thermometer" pattern: state k means the first k spins are +1 and the rest are -1. The "domain wall" between +1s and -1s sits at position k.

Constraint enforcement. Invalid spin configurations (with a -1 followed by a +1) are penalized by ferromagnetic nearest-neighbor couplings of strength P/4 within each position's spin chain. The constraint graph is a chain (K-2 edges), unlike one-hot encoding which requires a K-clique (K(K-1)/2 edges).

Ising weight compilation. Potts unary biases become Ising local fields via first differences: b_i = (h_i - h_{i-1})/2 plus boundary corrections. Potts pairwise interactions become inter-position couplings via mixed second differences: J_{(p,i),(q,j)} = (V_{ij} - V_{i-1,j} - V_{i,j-1} + V_{i-1,j-1}) / 4. This compilation is derived in ising/potts_to_ising.md and paper/supplement.tex.

GC-sorted codon ordering. Codons for each amino acid are sorted by (gc_count, alphabetical). Since single spin flips move the Potts variable to an adjacent state (k -> k+1), this ordering makes each spin flip change GC content by at most 1, creating a smooth landscape for the domain wall dynamics.

4-color block decomposition. The Ising graph has two types of edges: intra-position constraint chains and inter-position couplings (between adjacent amino acid positions). A 4-coloring based on (position_parity, spin_index_parity) ensures no two same-color spins share an edge, enabling parallel block Gibbs updates.

P-ramping. Both beta (inverse temperature) and P (constraint penalty) are annealed on independent log-spaced schedules. Low P early in annealing allows invalid-state (defect) transitions that provide shortcuts around energy barriers in the bias landscape. High P at the end enforces strict validity.

Key advantage of DWC: mixing time through the constraint chain is P-independent. At the domain wall boundary, the ferromagnetic couplings from the two neighbors cancel, so the Gibbs conditional depends only on the bias landscape, not on P.


Code Structure

codon_opt/                # repository root — run scripts from here
  problem.py              # Problem definition, energy functions, Potts weight computation
  script_utils.py         # CLI utilities: run directory setup, plotting, result I/O
  pyproject.toml          # uv / PEP 621 project metadata and dependencies
  requirements.txt        # pip dependency list (mirror of pyproject)
  README.md               # This file
  potts/
    model.py              # Potts model construction and sampling
    main.py               # CLI entry point for Potts sampling
  ising/
    dwc.py                # Domain Wall Encoding: weight compilation, state conversion
    ising_model.py        # Ising model construction and sampling
    ising_main.py         # CLI entry point for Ising sampling
    potts_to_ising.md     # Reference: Potts-to-Ising compilation derivations + literature review
  qodon/                  # Genetic-algorithm baseline (Fox et al.) + our JAX reimplementation
  tests/                  # Codon-specific tests (pytest)
  paper/                  # LaTeX source + compiled PDF of the companion paper

Note on imports. Modules use flat, top-level imports (from problem import ..., from potts.model import ...), so commands must be run from the repository root (e.g. python -m potts.main). The qodon/ scripts similarly expect to be run from within qodon/ (see that section).

problem.py — Problem Definition

Framework-agnostic module shared by both Potts and Ising models. Contains:

  • CODON_TABLE / SORTED_CODON_TABLE: standard genetic code and GC-sorted codon ordering.
  • CodonProblem: Equinox module holding the protein sequence, rarity scores, target GC, and weights.
  • compute_energy(problem, codon_seq): reference energy evaluation from codon strings.
  • compute_unary_biases(problem, linear_gc_coeff): Potts bias array [L, K_max] in GC-sorted ordering.
  • compute_pairwise_penalties(problem): pairwise repeat penalty array [L-1, K_max, K_max].
  • create_metrics_fn(problem) / create_energy_fn(problem): JIT-compiled energy evaluation from codon indices (single or batched via vmap).
  • create_gc_counter(problem): JIT-compiled GC count from codon indices.
  • adapt_gc_coeff(...): Lagrangian-style adaptive GC coefficient update with clamping.
  • indices_to_codons(problem, indices) / codons_to_nucleotides(codon_seq): index-to-string conversion.
  • get_ecoli_codon_rarity_scores() / get_default_rarity_scores(): host-specific codon frequency loading via python_codon_tables.
  • SPIKE_PROTEIN_SEQ: SARS-CoV-2 spike protein sequence (1273 amino acids), used as the default benchmark.

script_utils.py — CLI Utilities

Shared utilities for both entry points:

  • create_problem_from_args(args): construct CodonProblem from CLI arguments.
  • setup_run_directory(args): create timestamped output directory (with SLURM job ID if available).
  • compute_energies_over_samples(problem, samples): batch energy evaluation over [n_chains, n_samples, L] arrays.
  • save_results_json(...): save results, hyperparameters, and convergence stats to JSON.
  • plot_energy_convergence(...): 4-panel plot of total/usage/gc/repeat energy over sampling iterations.
  • plot_gc_adaptation_stats(...): GC fraction and coefficient trajectories over annealing.
  • plot_best_solution_stats(...): per-position GC content and rarity scores for the best solution.
  • print_results_summary(...): formatted text summary of the best solution.
  • compute_qodon_score(nucleotide_seq): optional comparison against the qodon SeqScorer.

potts/model.py — Potts Model

  • create_base_codon_model(problem, linear_gc_coeff): builds a FactorSamplingProgram with CategoricalEBMFactors for biases and pairwise penalties, 2-color block decomposition (even/odd), and CategoricalGibbsConditional samplers.
  • scale_model_by_beta(program, beta): scale all interaction weights by inverse temperature.
  • run_sampling(problem, key, n_chains, schedule, beta): fixed-temperature Gibbs sampling with vmap over chains.
  • run_annealing(problem, key, n_chains, steps_per_beta, betas, gc_coeff_adapt_mult, ...): simulated annealing via jax.lax.scan over the beta schedule. At each step: adapt GC coefficient, scale weights by beta, run Gibbs sweeps, record state. Supports per-chain GC coefficients, optional metrics computation, and trajectory or final-state-only output.
  • update_program_with_gc_coeff(program, new_gc_coeff_times_beta, editable_params): efficiently update program weights with the GC linear term using a precomputed diff.

potts/main.py — Potts CLI Entry Point

Supports two modes:

  • Fixed-beta sampling (default): run Gibbs sampling at a fixed inverse temperature.
  • Simulated annealing (--anneal): log-spaced beta schedule from beta_min to beta_max.

With optional --use_adaptive_gc_coeff for GC adaptation in either mode.

ising/dwc.py — Domain Wall Encoding

  • compute_spin_layout(Ks): precompute index arrays mapping between flat spin indices and (position, within-position index).
  • compute_ising_biases(potts_biases, potts_pairwise, Ks, P): compile Potts weights to Ising bias vector. JIT-compatible (Python control flow depends only on static Ks).
  • compute_ising_couplings(potts_pairwise, Ks, P): compute constraint edges (intra-position, weight P/4) and inter-position edges (weight = mixed second difference / 4).
  • potts_to_spin(potts_indices, pos_of_spin, spin_pos_index): convert Potts indices to thermometer spin states.
  • spin_to_potts(spin_bool, pos_matrix): convert spin states back to Potts indices via matrix multiply.

ising/ising_model.py — Ising Model

  • prepare_ising_statics(problem): one-time preparation of all static structures (spin layout, node objects, edge topology, 4-color block decomposition, precomputed vectorized arrays for fast weight computation inside JIT).
  • build_ising_program(statics, beta, P, gc_coeff): JIT-compatible construction of a FactorSamplingProgram from dynamic parameters using vectorized operations. Creates SpinEBMFactors for biases, constraint edges, and inter-position couplings.
  • run_ising_annealing(problem, key, n_chains, steps_per_beta, betas, Ps, gc_coeff_adapt_mult, ...): simulated annealing via jax.lax.scan with separate beta and P schedules. At each step: convert spin->Potts for GC computation, adapt GC coefficient, build Ising program with current (beta, P, gc_coeff), run Gibbs sweeps, convert back. Per-chain vmap over build_ising_program + sample_states.
  • create_ising_codon_model(problem, P, linear_gc_coeff): convenience wrapper for one-shot model creation.

ising/potts_to_ising.md — Reference Document

Comprehensive literature review and implementation plan covering: encoding schemes (one-hot vs. domain wall vs. binary), penalty strength and mixing time analysis, penalty scheduling, codon optimization on quantum/Ising hardware, the GC content term, DWC implementation details (codon ordering, P-ramping, mixing barriers), and the TSU target hardware.

tests/

  • test_potts_model.py: tests for problem utilities (GC count, repeat penalty, sorted ordering), unary biases, pairwise penalties, model creation, energy computation, annealing output shapes and convergence, GC adaptation behavior, and linear GC coefficient differentiability.
  • test_ising_model.py: tests for codon ordering, Potts<->spin state conversion roundtrips (including batched), energy equivalence between Potts and Ising formulations (exhaustive over all valid states), 4-color block decomposition validity, and constraint satisfaction rate under sampling.

Usage

Both sampling entry points are run as Python modules from the repository root. Output goes to a timestamped subdirectory under --output_dir (default: ./output/).

Potts Model

# Simulated annealing with adaptive GC (recommended)
uv run python -m potts.main \
  --seq "MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNI" \
  --anneal --beta_min 0.3 --beta_max 100 \
  --n_chains 256 --n_samples 100 --steps_per_sample 2 \
  --use_adaptive_gc_coeff --gc_coeff_adapt_mult 0.1 \
  --target_gc 0.5 --weight_usage 0.1 --weight_gc 2e4 --weight_repeat 0.2 \
  --codon_freqs ecoli --seed 42

# Fixed-beta sampling (simpler, no annealing)
uv run python -m potts.main --beta 1.0 --n_samples 100 --steps_per_sample 2

# Full spike protein
uv run python -m potts.main --seq spike_protein --anneal --use_adaptive_gc_coeff

Ising Model

The Ising sampler always uses simulated annealing with simultaneous P-ramping.

uv run python -m ising.ising_main \
  --seq "MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNI" \
  --beta_min 0.1 --beta_max 20 --P_min 1.0 --P_max 100 \
  --n_chains 256 --n_samples 1000 --steps_per_sample 10 \
  --use_adaptive_gc_coeff --gc_coeff_adapt_mult 0.1 \
  --target_gc 0.5 --weight_usage 0.1 --weight_gc 2e4 --weight_repeat 0.2 \
  --codon_freqs ecoli --seed 42

Common CLI Arguments

Argument Description
--seq Amino acid sequence (spike_protein for full 1273-AA)
--codon_freqs Codon frequency table: ecoli (E. coli K-12) or uniform
--target_gc Target GC fraction
--weight_usage Codon usage term weight (c_f)
--weight_gc GC content term weight (c_GC)
--weight_repeat Repeat penalty term weight (c_R)
--n_chains Number of parallel Gibbs chains
--n_samples Number of samples (Potts) or annealing steps (Ising)
--steps_per_sample Gibbs sweeps per sample or annealing step
--seed Random seed
--anneal Enable simulated annealing (Potts; always on for Ising)
--use_adaptive_gc_coeff Enable adaptive GC coefficient
--no_plot Skip plot generation
--output_dir Base output directory

The Ising model additionally accepts --P_min, --P_max, and --n_const_P_steps for the constraint penalty schedule: P stays at P_min for the first n_const_P_steps annealing steps, then ramps from P_min to P_max on a log schedule over the remaining steps.

Output

Each run creates a timestamped directory containing:

  • results.json: problem spec, hyperparameters, best solution (codons + nucleotides + GC content), energy breakdown, and convergence stats.
  • energy_convergence.png: 4-panel plot of energy terms over the sampling/annealing trajectory.
  • solution_stats.png: per-position GC content and codon rarity for the best solution.
  • gc_adaptation.png (if adaptive GC is enabled): GC fraction and coefficient trajectories.
  • run_log_*.txt: full text log of the run.

Running Tests

uv run pytest tests/          # or: pytest tests/  (inside an activated venv)

The qodon folder (genetic-algorithm baseline)

The qodon/ directory holds the genetic-algorithm (GA) baseline that the paper compares against. Its core GA, scoring, and constants modules are the reference implementation from:

Dillion M. Fox, Kim M. Branson, and Ross C. Walker. "mRNA codon optimization with quantum computers." PLOS ONE 16(10): e0259101 (2021). doi:10.1371/journal.pone.0259101.

That work was originally released as the quantum_codon_opt package under the GNU GPL v3 (see qodon/README.md); the license header is retained in the source files. We use it in two ways:

  • as a scoring oracleqodon/scoring.py's SeqScorer is used to cross-check our energy function (script_utils.compute_qodon_score), and
  • as the GA baseline reported in the paper.

qodon/fast_ga/ is our JAX reimplementation of the GA, with full JIT compilation of the generation loop, multi-chain parallelism, and the tuned hyperparameters used in the paper (population 200, 1000 generations, mutation rate 0.003).

qodon/ modules use flat imports and expect to be run from within the qodon/ directory. uv run discovers the project automatically from subdirectories:

# Original classical GA (Fox et al.) on the spike protein
cd qodon
uv run python run_ga_spike.py

# Tuned JAX reimplementation (the paper's GA benchmark)
cd qodon/fast_ga
uv run python run_spike.py

The GA can also be called directly on any amino-acid sequence:

# from within qodon/
from classical_ga import CodonOptimization
from scoring import SeqScorer

result = CodonOptimization("MFVFLVLLPLVSSQCVNLTTRT")
print(result.n_seq)                 # optimized nucleotide sequence
print(SeqScorer(result.n_seq).score)

The original qodon.py also exposes optional D-Wave and IBM quantum backends. Those require proprietary D-Wave libraries / Qiskit and external account access, and are not installed by this repo's dependencies; see qodon/README.md.


Citation

If you use this code, please cite the companion paper (see paper/; arXiv link forthcoming) and, for the GA baseline, Fox et al. (2021) above.

About

Codon optimization via Potts&Ising models

Resources

Stars

4 stars

Watchers

0 watching

Forks

Releases

Packages

Contributors

Languages