Skip to content

SanchithaK/AbInitioProteinStr

Repository files navigation

AbInitioProteinStr

Group 2: Ab Initio Protein Secondary Structure Prediction

Date: 12th December, 2024
Members: Arth Banka, Riti Bhatia, Sanchitha Kuthethoor, Sumeet Kothare
Demo Link: Project Demo

Project Motivation

Protein secondary structure prediction is a fundamental problem in computational biology. In this project, we explored early heuristic-based methods for predicting secondary structures from amino acid sequences. Our focus was on implementing and analyzing classical algorithms, including Chou-Fasman, GOR, and a Hidden Markov Model (HMM). Instead of using modern deep-learning-based methods like AlphaFold2, we aimed to understand and evaluate the performance of these earlier models in predicting secondary structures such as alpha helices, beta sheets, turns, and coils.

Computational Problem

The goal of this project was to develop a computational pipeline that, given an amino acid sequence, outputs a corresponding secondary structure sequence. The prediction accuracy was evaluated against DSSP-derived experimental secondary structures. Our models were designed to be lightweight, using minimal computational resources and classical probabilistic and statistical approaches instead of large-scale deep learning.

Folder Structure

AbInitioPS/
├── Figures/
│   ├── Miscellaneous ".png" files
├── GOR_InfoVals/
│   ├── InfoVal_aHelix.csv
│   ├── InfoVal_bStrand.csv
│   ├── InfoVal_bTurn.csv
│   ├── InfoVal_Coil.csv
├── GORTests/
│   ├── GORPredict/
│   │   ├── Input/
│   │   ├── Output/
│   ├── SlideWindow/
│       ├── Input/
│       ├── Output/
├── .RData
├── .Rhistory
├── AccuracyTestDataset_50.csv
├── AppUI.R
├── auto_Validation.R
├── CF_functions_test.go
├── CF_functions.go
├── datatypes.go
├── EM_main.go
├── GOR_functions_test.go
├── GOR_functions.go
├── hmm_functions_test.go
├── HMM_functions.go
├── main.go
├── README.md

Description of Files

  • CF_functions.go: Implements the Chou-Fasman algorithm.
  • CF_functions_test.go: Unit tests for Chou-Fasman functions.
  • datatypes.go: Defines shared data types.
  • EM_main.go: Implements Expectation-Maximization for HMM training.
  • GOR_functions.go: Implements the GOR algorithm.
  • GOR_functions_test.go: Unit tests for GOR method.
  • HMM_functions.go: Implements the Hidden Markov Model for structure prediction.
  • hmm_functions_test.go: Unit tests for HMM implementation.
  • main.go: Main entry point, integrating all models.
  • AppUI.R: RShiny application for sequence input and visualization.
  • auto_Validation.R: RShiny tool for validating model predictions.
  • AccuracyTestDataset_50.csv: Dataset used for model validation.
  • GOR_InfoVals/: Contains CSV files with informational values for different secondary structure types (e.g., Helix, Strand, Turn, Coil).
  • GORTests/GORPredict/Input/: Input test files for GOR prediction module.
  • GORTests/GORPredict/Output/: Output test files for GOR prediction module.
  • GORTests/SlideWindow/Input/: Input test files for sliding window functions.
  • GORTests/SlideWindow/Output/: Output test files for sliding window functions.

Building and Running the Go Code

Prerequisites

  • Go (1.18 or higher)
  • Operating System: macOS or Windows

Build Instructions

cd path/to/AbInitioPS
# Compile the main Go program
go build -o ProteinPredictor main.go

Run the Code

macOS/Linux:

./ProteinPredictor "ETGTVPAINYLGAGYDHVRGNPVGDPSSMGDPGIRPPVLRF"

Windows:

ProteinPredictor.exe "ETGTVPAINYLGAGYDHVRGNPVGDPSSMGDPGIRPPVLRF"

Running Tests

go test ./...

For testing specific modules:

go test -v CF_functions_test.go

Running the R Shiny Applications

Prerequisites

  • R (Version 4.1 or higher)
  • RShiny package installed: install.packages("shiny")
  • Additional Libraries: ggplot2, reshape2

Run AppUI.R

  1. Open RStudio.
  2. Load AppUI.R.
  3. Click Run App.
  4. Use the interface to:
    • Enter a protein sequence or upload a FASTA file.
    • Select Chou-Fasman, GOR, or HMM models.
    • View predicted structures and comparison graphs.

Run auto_Validation.R

  1. Open RStudio.
  2. Load auto_Validation.R.
  3. Click Run App.
  4. Upload a CSV file containing:
    • ProteinName
    • ProteinSequence
    • DSSPSequence
  5. Outputs include:
    • Per-protein accuracy.
    • Model-wise performance metrics.
    • Graphical comparisons of precision, recall, and F1-score.

Overview of Algorithms

Chou-Fasman (CF) Algorithm

A sliding window-based method that assigns propensity scores to amino acids, identifying helix and sheet nucleation sites. Overlapping predictions are resolved based on higher propensity values.

Garnier-Osguthorpe-Robson (GOR) Algorithm

Uses information theory to evaluate each amino acid's likelihood of forming a secondary structure based on neighboring residues. Employs probability tables derived from known protein structures.

Hidden Markov Model (HMM)

Models protein structures as hidden states in a Markov chain. Viterbi decoding is used to determine the most likely sequence of secondary structures based on trained transition and emission probabilities.

Mechanisms of CF and GOR Models

CF

Figure 1: This figure outlines the Chou-Fasman algorithm for secondary structure prediction in proteins, skipping certain steps for simplicity. It illustrates: a: Identifying favorable α-helix nucleation sites, b: Extending the helix window based on propensity scores, c: Locating favorable β-sheet nucleation sites, d: Using a sliding window to search for additional nucleation sites (unfavorable in this case), e: Searching for turn regions (propensity scores omitted), f: Marking favorable turn regions, g: Updating the predicted structure with identified regions, h: Resolving overlaps between predicted structures based on higher propensity scores.

GOR1

Figure 2: This figure demonstrates the calculation of information values using probabilities to predict the likelihood of an amino acid being part of a specific structural segment. The example focuses on residue Ala at position -2 in an α-helix, showing how probabilities are derived and combined to calculate the information measure (I(H, A, -2) ≈ 50). The table below provides directional information measures for various amino acids at different positions relative to the α-helical conformation.

GOR2

Figure 3: This figure provides a step-by-step calculation of structural information scores using the GOR method to predict secondary structures. It highlights: The sequence window around residue Ala at position -2, Directional information values from Table 1 for residues in the window, Summing individual contributions to calculate the total score (105), which supports predicting an α-helix at this position.

Model Performance and Validation

Accuracy

  • Chou-Fasman: 35.02%
  • GOR: 41.19%
  • HMM: 47.29%

Evaluation Metrics

  • Precision, Recall, and F1-Score calculated for Helices (H), Beta Sheets (E), Turns (T), and Coils (C).
  • HMM showed highest accuracy, but GOR had lower variance in predictions.
  • Turns were least accurately predicted across all models.

Contributions

  • Arth Banka: HMM research, implementation, and testing.
  • Riti Bhatia: Chou-Fasman implementation and testing.
  • Sanchitha Kuthethoor: RShiny UI development and model validation.
  • Sumeet Kothare: GOR implementation and visualizations.

References

  1. Chou, P. Y., & Fasman, G. D. (1978). Empirical predictions of protein conformation.
  2. Garnier, J., Osguthorpe, D. J., & Robson, B. (1978). Statistical prediction of secondary structures.
  3. Ding et al. (2012). PRT-HMM: A Novel Hidden Markov Model for Protein Secondary Structure Prediction.
  4. Kabsch, W., & Sander, C. (1983). DSSP: Dictionary of Protein Secondary Structure.
  5. McDonough, M. (2024). Did AI solve the protein-folding problem? Harvard Medicine Magazine.

About

No description, website, or topics provided.

Resources

Stars

0 stars

Watchers

1 watching

Forks

Releases

No releases published

Packages

 
 
 

Contributors